PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_15678_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 377aa    MW: 42330.9 Da    PI: 6.5008
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_15678_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.5e-181461148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                          +g+WT+eEd++l+d++++ G g+W+t ++  g+ R++k+c++rw +yl
  cra_locus_15678_iso_2_len_1253_ver_3 14 KGPWTPEEDQKLIDYIQKNGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                                          79********************************************97 PP

2Myb_DNA-binding54.42.9e-1767111147
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                           rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
  cra_locus_15678_iso_2_len_1253_ver_3  67 RGRFSFEEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                                           89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.623961IPR017930Myb domain
SuperFamilySSF466891.68E-3111108IPR009057Homeodomain-like
SMARTSM007175.9E-131363IPR001005SANT/Myb domain
PfamPF002493.6E-161461IPR001005SANT/Myb domain
CDDcd001676.16E-121661No hitNo description
PROSITE profilePS5129425.25562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-2665116IPR009057Homeodomain-like
SMARTSM007171.8E-1666114IPR001005SANT/Myb domain
PfamPF002491.3E-1567111IPR001005SANT/Myb domain
CDDcd001672.74E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MGRAPCCDKN GLKKGPWTPE EDQKLIDYIQ KNGYGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHSPRL DLLDLSSILN TSVYGSSSSH NQMNLSRLLG LQPLVNPELL RLATSLLSSQ  180
RKNQDFPILQ NQSQQNQFYS NPQLENHQLP PLVQDIPNCT ATLSTTCPPT CTTMDTVPFS  240
NVEQFSSNLP NFNSENCELN HWQNVGANFX DFAALQNYGY YGGGCGSGSE GQSMLDNIPT  300
ANSDTRTTFQ SNNSNNFSFQ SVLSNLSTPS SSPAPLNSSS TYINSSSTTT EDDREISYCS  360
NLLKFEIPDI LDVNEFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096186.11e-169PREDICTED: protein ODORANT1-like
TrEMBLA0A110A0K91e-158A0A110A0K9_COFCA; R2R3-MYB transcription factor 102
STRINGPGSC0003DMT4000576901e-152(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154